The short version of Heptapeptide fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-07-27 and is reviewed periodically as new material appears.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Melanotan II is a synthetic cyclic heptapeptide analog derived from the core sequence of alpha-melanocyte-stimulating hormone. Researchers at the University of Arizona synthesized it during the 1980s while studying pigmentation and appetite signaling. The compound is not an approved medicine in any major jurisdiction and appears mainly in laboratory and research-chemical settings. Its structure incorporates a lactam bridge between side chains, which constrains the ring and slows enzymatic breakdown relative to the natural hormone.
Melanotan II binds several melanocortin receptor subtypes rather than a single target. MC1R on melanocytes drives melanin synthesis, while MC3R and MC4R participate in energy balance, appetite, and sexual response pathways. This lack of selectivity explains why reported effects extend beyond skin darkening. Substitutions at positions four and seven, including norleucine and D-phenylalanine, increase potency and resistance to peptidases. Understanding which receptor mediates which effect remains an active area of investigation.
Published human data come mostly from small, short studies rather than large controlled trials. Reported outcomes include increased skin pigmentation and, in some reports, effects on appetite and libido, but sample sizes are small and follow-up is limited. Whether long-term use produces durable pigment changes or adverse effects is not established. Because products sold outside pharmacies are not standardized, the actual content of any given vial is often unknown. Independent testing of such material is uncommon.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic cyclic heptapeptide | Analogue of alpha-melanocyte-stimulating hormone |
| Common synonyms | MT-II; melanotan 2 | No internationally accepted non-proprietary name |
| Typical presentation | Lyophilised powder in a sealed vial | Often supplied alongside a separate diluent |
| Regulatory status | Unapproved therapeutic substance | Customs seizure reported in several jurisdictions |
| Reported route in use | Subcutaneous injection | Self-administered outside clinical settings |
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence incorporates a lactam bridge that constrains the peptide into a ring, which increases resistance to enzymatic breakdown relative to the natural hormone. Researchers at the University of Arizona synthesised the compound in the late 1980s and early 1990s while studying pigmentation pathways. It has never received marketing approval from any national medicines regulator. In the scientific literature it is usually described as a laboratory research reagent rather than a therapeutic product.
The peptide acts as a non-selective agonist at melanocortin receptors, showing affinity for MC1R, MC3R, MC4R and MC5R. Activation of MC1R on melanocytes drives the conversion of tyrosine into melanin and shifts production toward the darker eumelanin form. MC4R signalling in the central nervous system is linked to appetite and energy balance, which helps explain why reduced food intake appeared in early human studies. Effects on MC4R and on vascular tone also account for the erectile responses recorded as unexpected findings in those same trials.
The regulation of proline biosynthesis can depend on the initial controlling step through negative feedback inhibition. In E. coli, proline allosterically inhibits Glutamate 5-kinase which catalyzes the reaction from L-glutamate to an unstable intermediate L-γ-Glutamyl phosphate. Arginine synthesis also utilizes negative feedback as well as repression through a repressor encoded by the gene argR. The gene product of argR, ArgR an aporepressor, and arginine as a corepressor affect the operon of arginine biosynthesis. The degree of repression is determined by the concentrations of the repressor protein and corepressor level.
Over 10,000 people attended the monument's unveiling in September 1997. In the following months it was vandalised several times; in one instance it was daubed with the letters "AWB", an acronym of the Afrikaner Weerstandsbeweging, a far-right Afrikaner paramilitary group. In 1997, the cemetery where Biko was buried was renamed the Steve Biko Garden of Remembrance. The District Six Museum also held an exhibition of artwork marking the 20th anniversary of his death by examining his legacy. Also in September 1997, Biko's family established the Steve Biko Foundation. The Ford Foundation donated money to the group to establish a Steve Biko Centre in Ginsberg, opened in 2012. The Foundation launched its annual Steve Biko Memorial Lecture in 2000, each given by a prominent black intellectual. The first speaker was Njabulo Ndebele; later speakers included Zakes Mda, Chinua Achebe, Ngũgĩ wa Thiong'o, and Mandela. Buildings, institutes and public spaces around the world have been named after Biko, such as the Steve Bikoplein in Amsterdam. In 2008, the Pretoria Academic Hospital was renamed the Steve Biko Hospital. The University of the Witwatersrand has a Steve Biko Centre for Bioethics. In Salvador, Bahia, a Steve Biko Institute was established to promote educational attainment among poor Afro-Brazilians. In 2012, the Google Cultural Institute published an online archive containing documents and photographs owned by the Steve Biko Foundation. On 18 December 2016, Google marked what would have been Biko's 70th birthday with a Google Doodle.
The baculovirus-insect cell expression system has the ability to express a variety of recombinant proteins at high levels and provide significant eukaryotic protein processing capabilities, including phosphorylation, glycosylation, myristoylation and palmitoylation. Similar to mammalian cells, proteins expressed are mostly soluble, accurately folded, and biologically active. However, it has slower growth rate and requires higher cost of growth medium than bacteria and yeast, and confers toxicological risks. A notable feature is the existence of elements of control that allow for the expression of secreted and membrane-bound proteins in Baculovirus-insect cells. Licensed recombinant subunit vaccines that utilises baculovirus-insect cells include Cervarix (papillomavirus C-terminal truncated major capsid protein L1 types 16 and 18) and Flublok Quadrivalent (hemagglutinin (HA) proteins from four strains of influenza viruses).
Sources: en.wikipedia.org
In 1999 its parent company reorganized and changed its name to PE Corporation, and the PE Biosystems Group (formerly again became publicly traded, as a tracking stock of its parent, along with its sister tracking stock company, Celera Genomics. In 2000 the parent became Applera Corporation. The Applied Biosystems name also returned that year, in the name change of the tracking stock from PE Biosystems Group to Applera Corporation-Applied Biosystems Group, an S&P 500 company, which remains as a publicly traded operating group within Applera Corp., along with its sibling operating group, Applera Corporation-Celera Group. Applera derives its name from the combination of its two component groups' names, Appl(iedCel)era In November 2008, a merger between Applied Biosystems and Invitrogen was finalized "creating a global leader in biotechnology reagents and systems". The new company was called Life Technologies.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
== Hormonal regulation == Insulin is a peptide hormone that is critical for managing the body's metabolism. Insulin is released by the pancreas when blood sugar levels rise, and it has many effects that broadly promote the absorption and storage of sugars, including lipogenesis. Insulin stimulates lipogenesis primarily by activating two enzymatic pathways. Pyruvate dehydrogenase (PDH), converts pyruvate into acetyl-CoA. Acetyl-CoA carboxylase (ACC), converts acetyl-CoA produced by PDH into malonyl-CoA. Malonyl-CoA provides the two-carbon building blocks that are used to create larger fatty acids. Insulin stimulation of lipogenesis also occurs through the promotion of glucose uptake by adipose tissue. The increase in the uptake of glucose can occur through the use of glucose transporters directed to the plasma membrane or through the activation of lipogenic and glycolytic enzymes via covalent modification. The hormone has also been found to have long term effects on lipogenic gene expression. It is hypothesized that this effect occurs through the transcription factor SREBP-1, where the association of insulin and SREBP-1 lead to the gene expression of glucokinase. The interaction of glucose and lipogenic gene expression is assumed to be managed by the increasing concentration of an unknown glucose metabolite through the activity of glucokinase. Another hormone that may affect lipogenesis through the SREBP-1 pathway is leptin. It is involved in the process by limiting fat storage through inhibition of glucose intake and interfering with other adipose metabolic pathways.
Sources: en.wikipedia.org
Ypadú or ypadu (also known as mambé) is an unrefined, unconcentrated powder made from toasted coca leaves and the ash of various other plants. It is traditionally prepared and consumed by indigenous tribes in the Northwest Amazon. Like coca teas consumed in Peru to adapt to sickness induced by high elevation, it has a long ethnobotanical history and cultural associations.
=== XRF (X-ray fluorescence) === XRF (X-ray fluorescence) is also a common technique and is useful for both qualitative and quantitative data on ceramic samples. By analysing variations in secondary (fluorescent) X-rays scientists can identify, with significant accuracy, the various elements in the ceramic.
Because dextromethorphan (DXM) acts predominantly as the parent compound rather than through dextrorphan in Auvelity, the contribution of the active metabolite can largely be disregarded when analyzing Auvelity's pharmacological effects. Dextrorphan primarily provides NMDA channel blockade. However, DXM itself exhibits its strongest activity as a serotonin transporter (SERT) inhibitor and σ1 receptor agonist, while its NMDA antagonism is actually quite weak. In Auvelity, the conversion of DXM to dextrorphan by the CYP2D6 enzyme is substantially inhibited by bupropion, resulting in extremely high plasma concentrations of the parent DXM. Consequently, Auvelity's NMDA receptor antagonism is clinically quite limited, whereas σ1 receptor agonism and SERT inhibition become the dominant pharmacological actions. Based on pharmacokinetic data, it can be inferred that DXM in Auvelity may achieve approximately 60–85% whole-brain SERT occupancy, a level comparable to that of most SSRIs (selective serotonin reuptake inhibitors). In addition, σ1 receptor agonism, which was previously investigated as a target for antidepressant development, likely contributes to Auvelity's therapeutic efficacy. Bupropion produces relatively strong inhibition of the norepinephrine transporter (NET) and achieves approximately 14–28% dopamine transporter (DAT) occupancy, making it an NDRI (norepinephrine-dopamine reuptake inhibitor). Bupropion also antagonizes nicotinic acetylcholine receptors, acts as a weak positive allosteric modulator of the σ1 receptor, and inhibits 5-HT3 receptors.
=== Ancient cheesemaking === One of the ancient cheesemakers' earliest tools for cheesemaking, cheese molds or strainers, can be found throughout Europe and eastern Turkey dating back to the Bronze Age. Baskets were used to separate the cheese curds, but as technology advanced, these cheese molds would be made of wood or pottery. The cheesemakers placed the cheese curds inside of the mold, secured the mold with a lid, then added pressure to separate the whey, which would drain out from the holes in the mold. The more whey that was drained, the less moisture retained in the cheese. Less moisture meant that the cheese would be firmer. In Ireland, some cheeses ranged from a dry and hard cheese (mullahawn) to a semi-liquid cheese (millsén). The designs and patterns were often used to decorate the cheeses and differentiate between them. Since many monastic establishments and abbeys owned their share of milk animals at the time, it was commonplace for the cheeses they produced to bear a cross in the middle. Although the common perception of cheese today is made from cow's milk, goat's milk was actually the preferred base of ancient cheesemakers, because goats are smaller animals than cows. This meant that goats required less food and were easier to transport and herd. Moreover, goats can breed any time of the year as opposed to sheep, who also produce milk, but mating season only came around during fall and winter.
Sources: en.wikipedia.org
No. No major regulatory agency has granted a marketing authorisation for melanotan II as a medicine. Products sold under this name are generally presented as laboratory reagents and are not subject to the batch-release testing applied to approved drugs.
It was developed in the 1980s by researchers investigating analogues of alpha-melanocyte-stimulating hormone for pigmentation and related endpoints. Early work included small human studies during the 1990s. Development did not progress to licensing, and the compound remained a research and grey-market item.
Peptides are prone to truncation, oxidation and aggregation during synthesis and handling. Without independent testing, a buyer cannot confirm the identity or the content of a vial. Analytical surveys of unapproved peptide products have repeatedly found discrepancies between label claims and measured composition.
No regulator in a major market has approved it for human use. It appears in research settings and in products marketed outside pharmacy channels. Legal status for personal possession varies by country.