Related impurities raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-11-07 and is reviewed periodically as new material appears.
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
The peptide acts as a non-selective agonist at melanocortin receptors, showing affinity for MC1R, MC3R, MC4R and MC5R. Activation of MC1R on melanocytes drives the conversion of tyrosine into melanin and shifts production toward the darker eumelanin form. MC4R signalling in the central nervous system is linked to appetite and energy balance, which helps explain why reduced food intake appeared in early human studies. Effects on MC4R and on vascular tone also account for the erectile responses recorded as unexpected findings in those same trials.
Melanotan-2 is frequently confused with afamelanotide, a linear analogue authorised in the European Union for erythropoietic protoporphyria. The two compounds differ in chain length, ring structure and receptor selectivity, so findings for one cannot be transferred directly to the other. Published controlled human data on melanotan-2 remain sparse, and much of what circulates online derives from small studies or unpublished reports. Questions about effect size, dose-response behaviour and long-term safety therefore remain unresolved.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilised material may be hygroscopic |
| Solubility class | Soluble in water, DMSO and DMF | Dilution into aqueous buffer can cause precipitation |
| Storage of solid | Minus 20 degrees C, desiccated, dark | Aliquot to limit repeated opening of the vial |
| Storage of solution | Minus 20 to minus 80 degrees C, aliquoted | Avoid repeated freeze-thaw cycles |
| Identity method | Reversed-phase HPLC with mass spectrometry | Retention time and mass are checked together |
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
Lyophilised peptide powder is comparatively stable when kept dry, cold and protected from light. Once dissolved, the molecule is exposed to hydrolysis, oxidation and microbial growth, and degradation accelerates at higher temperatures and in alkaline solution. Repeated freeze-thaw cycles concentrate solutes and promote aggregation. Handling guidance for research peptides commonly clusters around freezer temperatures for powder and short refrigerated use for reconstituted solutions, with pH control and sterile technique applied throughout.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
== Role == Acetyl-CoA is a metabolic intermediate that is involved in many metabolic pathways in an organism. It is produced during the breakdown of glucose, fatty acids, and amino acids, and is used in the synthesis of many other biomolecules, including cholesterol, fatty acids, and ketone bodies. Acetyl-CoA is also a key molecule in the citric acid cycle, which is a series of chemical reactions that occur in the mitochondria of cells and is responsible for generating energy in the form of ATP. In addition, acetyl-CoA is a precursor for the biosynthesis of various acetyl-chemicals, acting as an intermediate to transfer an acetyl group during the biosynthesis of those acetyl-chemicals. Acetyl-CoA is also involved in the regulation of various cellular mechanisms by providing acetyl groups to target amino acid residues for post-translational acetylation reactions of proteins.
==== New Zealand ==== This is known as creaming soda, ice cream soda, chill drink, or cream soda, though the flavor changes are negligible. It is usually a bright yellow colour or a white opaque. It is one of the many flavors sold by Foxton Fizz. It is also one of the many carbonated drink-flavors offered by Golden Circle.
=== Skin === Deficiencies in vitamin A and retinoic acid have been linked to an increased susceptibility to skin infection and inflammation. Vitamin A appears to modulate the innate immune response and maintains homeostasis of epithelial tissues and mucosa through its metabolite, retinoic acid (RA). As part of the innate immune system, toll-like receptors in skin cells respond to pathogens and cell damage by inducing a pro-inflammatory immune response which includes increased RA production. The epithelium of the skin encounters bacteria, fungi and viruses. Keratinocytes of the epidermal layer of the skin produce and secrete antimicrobial peptides (AMPs). Production of AMPs resistin and cathelicidin, are promoted by RA. Another way that vitamin A helps maintain a healthy skin and hair follicle microbiome, especially on the face, is by reduction of sebum secretion, which is a nutrient source for bacteria. Retinol is used topically, in often unregulated cosmetic applications, claiming to mitigate the visible effects of ageing on the skin. Clinical and histological improvement is observed, but is not maintained after application is discontinued. When applied topically there is very little systemic absorption through the skin. Retinol has been the subject of clinical studies regarding its ability to reduce fine wrinkles and roughness on the face and neck. All-trans retinol has been used in over-the-counter cosmetic products since 1984.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
Election forensics is the use of statistics to determine if election results are normal or abnormal. It is also used to look into and detect the cases concerning gerrymandering. Forensic accounting is the study and interpretation of accounting evidence, financial statement namely: Balance sheet, Income statement, Cash flow statement. Forensic aerial photography is the study and interpretation of aerial photographic evidence. Forensic anthropology is the application of physical anthropology in a legal setting, usually for the recovery and identification of skeletonized human remains. Forensic archaeology is the application of a combination of archaeological techniques and forensic science, typically in law enforcement. Forensic astronomy uses methods from astronomy to determine past celestial constellations for forensic purposes. Forensic botany is the study of plant life in order to gain information regarding possible crimes. Forensic chemistry is the study of detection and identification of illicit drugs, accelerants used in arson cases, explosive and gunshot residue. Forensic dactyloscopy is the study of fingerprints. Forensic document examination or questioned document examination answers questions about a disputed document using a variety of scientific processes and methods. Many examinations involve a comparison of the questioned document, or components of the document, with a set of known standards. The most common type of examination involves handwriting, whereby the examiner tries to address concerns about potential authorship.
== Use and effects == According to Alexander Shulgin in his book TiHKAL (Tryptamines I Have Known and Loved), ETH-LAD has a dose of 40 to 150 μg orally and a duration of 8 to 12 hours. However, it also produced clear effects at a dose of 20 μg, and in other publications, Shulgin gave a lower dose range for the drug of 40 to 80 μg. Its onset ranges from 15 minutes to 1 hour and peak effects occur after about 1 to 2 hours. Shulgin has stated that ETH-LAD is "a little more potent" than LSD or roughly twice as potent as LSD in humans. Other researchers have described it as "slightly more potent" or "somewhat more potent" than LSD in humans. For comparison, Shulgin lists the dose range of LSD as 60 to 200 μg or 50 to 200 μg in his publications. Based on the preceding findings, ETH-LAD is one of the most potent serotonergic psychedelics known in humans, if not the most potent known psychedelic. As a result of this, it has been said that LSD can no longer be considered the most potent psychedelic. The effects of ETH-LAD have been reported to include closed-eye imagery, very few visual changes or distortions, gentle movements of objects, LSD-like visual aspects, two-dimensional surfaces looking three-dimensional, objects looking "magical", and possible time slowing. It was described as making the body feel balanced, thinking being easy, concepts easy to follow through, mind capable of realistic and down-to-earth thought, and warmth and humor being present.
The player is introduced to Aperture in Portal, which is said by Valve to be set sometime between the events of Half-Life and Half-Life 2. The player-character Chell is awakened by GLaDOS for testing. Chell resists GLaDOS' lies and verbal ploys and succeeds in defeating GLaDOS' core. The destruction creates a portal implosion that sends Chell to the surface and leaves her unconscious. Rattmann, who has helped Chell by writing warning messages and directions to maintenance areas on the facility walls and had observed the final battle, escapes Aperture, but on witnessing a robot dragging Chell's body back inside, sacrifices his escape to assure that Chell is put into indefinite cryogenic storage. He himself is critically wounded but appears to make it to another cryogenic chamber, though his ultimate fate is not revealed. Portal 2 takes place an unknown number of years after the events of the first game; the Aperture facility has fallen into disrepair without GLaDOS. A personality core named Wheatley (Stephen Merchant) wakes Chell from her sleep to help her stop a reactor failure, but inadvertently awakens GLaDOS, who had backed up her personality. Though they defeat GLaDOS by putting Wheatley in control of the facility, Wheatley is overwhelmed with power, sending Chell and GLaDOS, GLaDOS being temporarily reduced to a small computer powered by a potato, to the old core of Aperture, where GLaDOS rediscovers her relation to Caroline.
Sources: en.wikipedia.org
Purity is normally stated as an area percentage from high-performance liquid chromatography, for example ninety-five or ninety-eight percent. That figure describes the proportion of ultraviolet-absorbing material eluting as the main peak. It says nothing about water content, counterions, residual solvents or mass fraction of the peptide itself.
Peptides are commonly isolated as acetate or trifluoroacetate salts, and the counterion contributes to total mass. Two vials with identical peptide content can therefore differ in weight and in measured response. Residual trifluoroacetate is also relevant in cell-based work because it can influence membrane behaviour.
Degradation products are often closely related to the parent molecule, making them hard to resolve with a single method. Counterion variability adds a further source of scatter between laboratories. Because no pharmacopoeial monograph exists for melanotan-2, groups rely on method-specific validation rather than a shared reference standard.
It is a synthetic cyclic heptapeptide modelled on alpha-melanocyte-stimulating hormone. A lactam bridge links two side chains, forming a ring that stabilises the molecule against proteolysis. It belongs to the broader melanocortin peptide family.